Protein Info for RR42_RS05690 in Cupriavidus basilensis FW507-4G11

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 12 to 206 (195 residues), 328 bits, E=1.1e-102
• PF02492: cobW
  • amino acids 14 to 184 (171 residues), 140 bits, E=6.8e-45

Best Hits

Swiss-Prot: 96% identical to UREG_CUPNH: Urease accessory protein UreG (ureG) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03189, urease accessory protein (inferred from 96% identity to reu:Reut_A0998)

MetaCyc: 64% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (5/8 steps found)

Sequence Analysis Tools

See A0A0C4Y0U2 at UniProt or InterPro

Protein Sequence (209 amino acids)

>RR42_RS05690 urease accessory protein UreG (Cupriavidus basilensis FW507-4G11)
MTQARTKKNPPLRVGVGGPVGSGKTTLLEMLCKAMRERYDLVAITNDIYTKEDQRLLTIS
GALPAERIMGVETGGCPHTAIREDASINLEAVDRMLGKFPDADIVFIESGGDNLAATFSP
ELSDLTIYVIDVAGGEKIPRKGGPGITKSDLLVINKTDLAPYVGANLEVMESDARKMRGA
RPFVMGSVKSGQGLAEVIAFIERQGMLGV