Protein Info for RR42_RS05640 in Cupriavidus basilensis FW507-4G11

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 55 to 369 (315 residues), 440 bits, see alignment E=3.5e-136 PF02653: BPD_transp_2" amino acids 62 to 358 (297 residues), 138.5 bits, see alignment E=1.2e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 87% identity to reu:Reut_A0988)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCZ6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>RR42_RS05640 amino acid ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MKTSLPNSSTAGFRLAVPERQPLFSGRSWTALLMIALVVGIGVPVCALLVPEGHPMHLSA
YALTLIGKIMCFALAAIALDLVWGYCGILSLGHGLFFALGGYAMGMYLMRSIGREGVYKS
DLPDFMVFLDWKEMPWFWHGTEHLGYAMLLVVLVPGVLAWLFGFFAFRSRIKGVYLSIIT
QAMTYAAMLLFFRNETGFGGNNGFTDFKRVAGFAVAAPQTRTALFVLTFLALLAGFIACR
YIVTSKLGRVVTAIRDAEMRVMFSGYNPLGYKLFVWTFSAVLCGIAGALYVPQVGIINPG
EMSPANSIEMAVWVAVGGRGTLIGPIIGAFIVNGAKTMFTAYFAEYWLFLLGAMFVLVTL
YMPDGVIGLLKRARAMRASPQAAPGNAATAPAAATRSGGEA