Protein Info for RR42_RS05635 in Cupriavidus basilensis FW507-4G11

Annotation: urea ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 237 to 262 (26 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details amino acids 462 to 488 (27 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 235 to 526 (292 residues), 424.9 bits, see alignment E=1e-131 PF02653: BPD_transp_2" amino acids 237 to 512 (276 residues), 155.7 bits, see alignment E=6.8e-50

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 86% identity to reh:H16_A1076)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6C2 at UniProt or InterPro

Protein Sequence (530 amino acids)

>RR42_RS05635 urea ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MLAALLLLAACPLWAAPLTQADLKPLAEDDFDAKTAAITALIKAPVAQAGPILKALQDDT
LQYAPGVGMVRQDGDKLVDAISGTPVTVKPDALEALTLNNSLRAMVDSAASSTLLQSPDA
AVRTQAVNTLLDQPGSASRPVVEAARKAEADAGLRSKLDVIWANIVLADGNRDDRLEAIR
ILGRDSNPQSRQKLQPLLEKDAAGNFREPDAELRGAAQQALDALRGDQRRAELIGNLFAG
LSLGSVLLLAALGLAITYGLIGVINMAHGEFLMIGAYATYMVQGVFRAHFASAFDWYLLF
ALPASFLASAVVGFVLERLVLRHLYGRPLETLLATFGVSLLLMQAVRTLFGAQNVEVANP
SWMSGGIEWLPGMVLPYNRMVIIVFALAVVAVAWAVLNRTRLGLFVRATTQNRTMAACVG
VRTWKVDSYAFAFGAGIAGLGGCALSQIGNVGPDLGQAYIIDSFMVVVLGGVGQLAGTII
GAFGLGLINKFIEPFYGAVLAKIFVLVLIVLFIQKRPQGLFALKGRSAEA