Protein Info for RR42_RS05630 in Cupriavidus basilensis FW507-4G11

Annotation: branched-chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 34 to 389 (356 residues), 255.8 bits, see alignment E=9.5e-80 PF13433: Peripla_BP_5" amino acids 35 to 409 (375 residues), 564 bits, see alignment E=1.5e-173 TIGR03407: urea ABC transporter, urea binding protein" amino acids 35 to 407 (373 residues), 600.6 bits, see alignment E=4.4e-185

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 96% identity to reh:H16_A1075)

Predicted SEED Role

"Urea ABC transporter, urea binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8P8 at UniProt or InterPro

Protein Sequence (421 amino acids)

>RR42_RS05630 branched-chain amino acid ABC transporter substrate-binding protein (Cupriavidus basilensis FW507-4G11)
MKRRDMLKLSAVATAALFATAGVSPLALAQSKEPIKVGILHSLSGTMAISETSLKDVALM
TIDEINKSGGVLGRKLEPVVVDPASNWPLFAEKARQLITKDKVAVTFGCWTSVSRKSVLP
VYEELNSLLFYPVQYEGEEMSKNVFYTGAAPNQQAIPAVEYLMSKEGGGAKRFFLLGTDY
VYPRTTNKILRAFLKSKGVADKDIEEVYTPFGHSDYQTIVANIKKFSQGGKTAVISTING
DSNVPFYKELGNAGLKAKDVPVVAFSVGEEELRGIDTKPLVGHLAAWNYFMSVKNPENEA
FKKQWAAWVKANNLPGGDKRVTNDPMEATYVGIHMWAQAVKKAGTTDPDKVRAAMYGQTF
KAPDGFTLTMGENHHLYKPVMIGEIKGDGQFTVVWKTPKAVRAQPWSPFIAGNEGKPDKV
M