Protein Info for RR42_RS05495 in Cupriavidus basilensis FW507-4G11

Annotation: triosephosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00121: TIM
  • amino acids 4 to 244 (241 residues), 306.3 bits, E=8.1e-96
• TIGR00419: triose-phosphate isomerase
  • amino acids 5 to 237 (233 residues), 195.1 bits, E=7.6e-62

Best Hits

Swiss-Prot: 88% identical to TPIS_CUPNJ: Triosephosphate isomerase (tpiA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 88% identity to reu:Reut_A0959)

MetaCyc: 49% identical to triose-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• gluconeogenesis III (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• oxygenic photosynthesis (10/17 steps found)
• glycerol degradation to butanol (9/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

See A0A0C4Y6I1 at UniProt or InterPro

Protein Sequence (245 amino acids)

>RR42_RS05495 triosephosphate isomerase (Cupriavidus basilensis FW507-4G11)
MRQKLVIGNWKMHGSLAANVTLLEAIKAAPASARLAVCAPFPYLAQCQALLAGSAVAWGA
QDVSAEARGAFTGEVAASMLAEFGASYALVGHSERRSYHGETDATVAAKAVRALEFGIVP
VVCVGESLAQREAGETEAVVGRQLGAVLEALSLDQLGRIVLAYEPVWAIGTGKTASSEQA
QAVHAFLRAQVAARDAGVAARMAMLYGGSVKPDNAAELFSMPDIDGGLIGGASLKSDDFL
AIGNA