Protein Info for RR42_RS05445 in Cupriavidus basilensis FW507-4G11

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00670: AdoHcyase_NAD
  • amino acids 12 to 99 (88 residues), 27.3 bits, E=1.3e-09
• PF02826: 2-Hacid_dh_C
  • amino acids 12 to 102 (91 residues), 28.8 bits, E=2.8e-10
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 14 to 326 (313 residues), 439.1 bits, E=3.8e-136
• PF07991: IlvN
  • amino acids 14 to 177 (164 residues), 245.4 bits, E=7.5e-77
• PF03807: F420_oxidored
  • amino acids 19 to 95 (77 residues), 31.7 bits, E=6.6e-11
• PF03446: NAD_binding_2
  • amino acids 19 to 103 (85 residues), 29.3 bits, E=2.9e-10
• PF01450: IlvC
  • amino acids 183 to 326 (144 residues), 217.3 bits, E=3.6e-68

Best Hits

Swiss-Prot: 97% identical to ILVC_CUPNH: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 96% identity to rpi:Rpic_2226)

MetaCyc: 97% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

See A0A0C4YCW0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RR42_RS05445 ketol-acid reductoisomerase (Cupriavidus basilensis FW507-4G11)
MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHAQNLNDSGVKVTVGLRKSGASWNKAVNAG
LQVKEVADAVKDADVVMILLPDEQIADVYKNEVHDNIKQGAALAFAHGFNVHYGAVIPRA
DLDVIMIAPKAPGHTVRSTYAQGGGVPHLIAVHQDKSGAARDIALSYATANGGGRAGIIE
TNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYE
GGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDIQTGEYAKSFLLENKAGAPT
LISRRRLTAEHQIEEVGAKLRAMMPWIAKNKLVDQSKN