Protein Info for RR42_RS05325 in Cupriavidus basilensis FW507-4G11

Annotation: adenine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01430: adenosine deaminase
  • amino acids 15 to 333 (319 residues), 382 bits, E=1.1e-118
• PF00962: A_deaminase
  • amino acids 15 to 335 (321 residues), 315.4 bits, E=2.2e-98

Best Hits

Swiss-Prot: 88% identical to ADE_CUPNH: Adenine deaminase (H16_A1014) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 88% identity to reh:H16_A1014)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• superpathway of purine deoxyribonucleosides degradation (2/7 steps found)
• purine ribonucleosides degradation (1/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

See A0A0C4Y6E2 at UniProt or InterPro

Protein Sequence (348 amino acids)

>RR42_RS05325 adenine deaminase (Cupriavidus basilensis FW507-4G11)
MTLDAALADRIRQTPKAELHVHIEGTLEPELIFRLAQHNKVKLPYASVEALREAYAFTDL
QSFLDIYYAGASVLLTEDDFFDMTMAYVQRAVADNVRHAEIFFDPQTHTERGVPIHVVID
GISDALAQARTQYDFSSSLILCFLRHLSEEDAFATLEAALPYRDRFVGIGLDSSEQGNPP
EKFARVFARARELGLHLVAHAGEEGPAQYVTDALDILKVERIDHGVRAIDDPALVERLAR
ERVALTVCPLSNQKLKVYPDLRDHSLHRLLEAGVLVTLHSDDPAYFGGYMNANWEAAFEA
LPLTAADGHKLARNSFEASFLPASQKTAFLAEVDHFWQSPLPAAASTA