Protein Info for RR42_RS05105 in Cupriavidus basilensis FW507-4G11

Annotation: 2-keto-4-pentenoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 65 to 254 (190 residues), 54.5 bits, E=6.6e-19

Best Hits

Swiss-Prot: 65% identical to TODJ_PSEP1: TodF product hydratase (todJ) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01617, 4-oxalocrotonate decarboxylase [EC: 4.1.1.77] (inferred from 69% identity to bpy:Bphyt_1466)

MetaCyc: 65% identical to 2-oxopent-4-enoate hydratase (Pseudomonas putida F1)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]

Predicted SEED Role

"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)

MetaCyc Pathways

• L-tryptophan degradation IX (11/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (11/12 steps found)
• mandelate degradation to acetyl-CoA (15/18 steps found)
• meta cleavage pathway of aromatic compounds (9/10 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (4/4 steps found)
• 2-nitrobenzoate degradation I (6/7 steps found)
• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (6/7 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
• 2-aminophenol degradation (3/4 steps found)
• 3-chlorocatechol degradation III (meta pathway) (3/4 steps found)
• catechol degradation to 2-hydroxypentadienoate II (3/4 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• orthanilate degradation (3/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (3/5 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
• 4-amino-3-hydroxybenzoate degradation (3/6 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
• 2,3-dihydroxybenzoate degradation (2/5 steps found)
• 4-chloronitrobenzene degradation (4/9 steps found)
• 4-nitrotoluene degradation II (4/9 steps found)
• superpathway of aerobic toluene degradation (19/30 steps found)
• naphthalene degradation to acetyl-CoA (6/12 steps found)
• p-cumate degradation (3/8 steps found)
• p-cymene degradation (4/11 steps found)
• 2,2'-dihydroxybiphenyl degradation (2/10 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.77, 4.2.1.80

Use Curated BLAST to search for 4.1.1.77 or 4.2.1.80

Sequence Analysis Tools

See A0A0C4Y0L9 at UniProt or InterPro

Protein Sequence (263 amino acids)

>RR42_RS05105 2-keto-4-pentenoate hydratase (Cupriavidus basilensis FW507-4G11)
MRAAADLLWQAHAGHAPCLPVRTLIGETDPRAAYQVQEINTQRWLAAGRRLVGRKIGLTS
RAVQQQLGVGEPDFGMLFADMAVAEGEEIDLRRVLQPRIEAEIALVLAHPLAHERHTIAD
LIRATAYALPAAEIVGSRVANWDIRLNDTIADNASSGLFALGSRPVKLADLDLIGCGMAM
ERRGEQVSLGAGAACLGNPLHAALWLADTMVRVGRPLQAGDIVMTGALGPMVPVAAGDVF
DLEIEGLGRLSTRFAPANKEPSA