Protein Info for RR42_RS04795 in Cupriavidus basilensis FW507-4G11

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 291 to 322 (32 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 68 to 349 (282 residues), 147.8 bits, see alignment E=1.8e-47

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 89% identity to reh:H16_A0937)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y861 at UniProt or InterPro

Protein Sequence (366 amino acids)

>RR42_RS04795 sugar ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MADFLPRSPLSLAPRGLPSRRMAYASPFIALALTLAFGALLFLLLGKDPVAALKVFLIDP
LKDRRAIGEVLLKTVPLVLCALGLSVCYRANIWNIGADGQLIVGGIFAGATVLYFDVPGH
GVNGTVVLVLASLAGVAGGMFWASLTAALKDKFNANEILVSLMLTYIAQQLMLYVVNGPL
KDPNGMNFPQSKVFSSEFLLPNLMSGSRLHAGFVVMLVLVVLMTVFIFRSFAGYRLQVGG
TAPAAARYAGFSARRSLWSALMISGGTAGLAGAFEVTGPIGQLLPSISPGYGFTAIIVAF
VGRLHPVGTVFGGIVMSLFYIGGEMAQSRLGLPSALGSVFQGMLLFFLLASDTLIDNRLR
WRAKAA