Protein Info for RR42_RS04790 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 279 (272 residues), 110.7 bits, see alignment E=3.5e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 94% identity to reu:Reut_A2500)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y647 at UniProt or InterPro

Protein Sequence (306 amino acids)

>RR42_RS04790 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MEQLAPLIATAINAGTPLLLAALGLLINERAGVLNLGAEGMMLVAAAFGFMVGYQTQSPL
IGFAAGALAGMLMATLFSWLALVLATNQVATGLALSIFGTGLSAFMGQRFVGFAMPSQAK
SIPWLADIPFFGPAFFQQHWMVYFSLFLCGAIMWFLFRTRAGLTLRAIGESPESAHALGY
PVRLIRFGALLFGGACCGLAGAYLSLVYTPMWVENLVAGRGWIALALTTFATWRPGRVWA
GAWLFGGVTILQFYLQGIGVSVPSQILSMLPYAATIVVLALISRNPAWIRLNMPASLGKP
FRPGAA