Protein Info for RR42_RS04670 in Cupriavidus basilensis FW507-4G11

Annotation: lipid transporter ATP-binding/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 71 to 97 (27 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 17 to 587 (571 residues), 821.2 bits, see alignment E=2.3e-251 PF00664: ABC_membrane" amino acids 32 to 302 (271 residues), 149.3 bits, see alignment E=1.8e-47 PF00005: ABC_tran" amino acids 363 to 515 (153 residues), 118.3 bits, see alignment E=4.2e-38

Best Hits

Swiss-Prot: 85% identical to MSBA_CUPMC: Lipid A export ATP-binding/permease protein MsbA (msbA) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 85% identity to rme:Rmet_0757)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y0F4 at UniProt or InterPro

Protein Sequence (589 amino acids)

>RR42_RS04670 lipid transporter ATP-binding/permease (Cupriavidus basilensis FW507-4G11)
MKVQEQNAPPAQEADTLKRVWSYLRPEMRVFIVAIIAMAAVAGAEGIMPKVVNDLLDNGF
GGAYAGKLWHVPALLIGVALVRGVAQFASGYLLALISNRVLLKMRMQMFERMLHAPALFY
HRNTAASLINAVIFEVNQVMQILTGVLITLVRDSLTVLALLVYLFYTNWSLTLVVAVILP
VIGFVMAKVNRRLRRLNRDHQALTNTAAYVVEEAAGGYKVVKLHGGEAYETSRFAAMAER
LRGYSMRMAVAGGLNQPVTAFLAALALSVILTIAMIQSQTNHTTVGSFTGFVMAMLLLVS
PLKHLTDLNQPLQRGLTAAEMIFGLIDEPIEPQDGGLPLERARGELVFEKVGFRYGEAAR
PALDNINFNVSAGEVVALVGPSGSGKTTLVNLVPRFFDPTEGRILLDGKTIDAFSLHDLR
RQIAFVSQDVVLFNDTVAANVAYGVHPAAEIDMARVERALAAAYLTDVIKGLPQGLETNI
GDNGMKLSGGQRQRMAIARALYKDAPILILDEATSALDSESERQVQAALEALMVGRTTLV
IAHRLSTIENADRIVVLDHGRVAEHGTHDELLSAEGLYAGLHRIQFATQ