Protein Info for RR42_RS04625 in Cupriavidus basilensis FW507-4G11

Annotation: 16S rRNA processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR02273: 16S rRNA processing protein RimM" amino acids 56 to 232 (177 residues), 134.6 bits, see alignment E=1.1e-43 PF01782: RimM" amino acids 57 to 152 (96 residues), 56.9 bits, see alignment E=2.1e-19 PF05239: PRC" amino acids 158 to 230 (73 residues), 41.9 bits, see alignment E=8.2e-15

Best Hits

Swiss-Prot: 74% identical to RIMM_CUPNJ: Ribosome maturation factor RimM (rimM) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 74% identity to reu:Reut_A2539)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y621 at UniProt or InterPro

Protein Sequence (235 amino acids)

>RR42_RS04625 16S rRNA processing protein RimM (Cupriavidus basilensis FW507-4G11)
MTERKQGAPARRPLNVPLEPSARREAGEQEKPSLKRGATGLPAALAYTDKLPDDLIEVGY
IGAAYGIRGWIKVQPHADDAGALLHARRWWLLKPPPTGLVGAADAVASEALCVKIVQSRE
HSGTVVAQASGVSERNHSEALKGRRVWIRREDFPAPDENEFYWVDLIGCAVFNEQGESLG
EVSGLIDNGAHQILQVAHALPDGKAGERLIPFVDAFLRSVDISARRVVVDWGLDY