Protein Info for RR42_RS04435 in Cupriavidus basilensis FW507-4G11

Annotation: 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 25 to 242 (218 residues), 277.1 bits, see alignment E=4.4e-87 PF06325: PrmA" amino acids 52 to 168 (117 residues), 29.7 bits, see alignment E=2.3e-10 PF01209: Ubie_methyltran" amino acids 60 to 190 (131 residues), 36.6 bits, see alignment E=1.6e-12 PF13489: Methyltransf_23" amino acids 63 to 218 (156 residues), 86.2 bits, see alignment E=1e-27 PF05175: MTS" amino acids 64 to 135 (72 residues), 23.2 bits, see alignment E=2.4e-08 PF13847: Methyltransf_31" amino acids 64 to 173 (110 residues), 60.1 bits, see alignment E=1.1e-19 PF02353: CMAS" amino acids 64 to 177 (114 residues), 31.8 bits, see alignment E=4.9e-11 PF07021: MetW" amino acids 65 to 153 (89 residues), 21.1 bits, see alignment E=1e-07 PF13649: Methyltransf_25" amino acids 68 to 161 (94 residues), 64.4 bits, see alignment E=6.6e-21 PF08241: Methyltransf_11" amino acids 69 to 165 (97 residues), 75.9 bits, see alignment E=1.6e-24 PF08242: Methyltransf_12" amino acids 69 to 163 (95 residues), 59.2 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 85% identical to UBIG_CUPNJ: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 87% identity to cti:RALTA_A0768)

MetaCyc: 58% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5Z2 at UniProt or InterPro

Protein Sequence (249 amino acids)

>RR42_RS04435 3-demethylubiquinone-9 3-methyltransferase (Cupriavidus basilensis FW507-4G11)
MTQISSPLHPTVETTLIGKNADAREIDKFSELAHRWWDPESEFKPLHELNPLRLGWIDGI
ASLKGKDVVDIGCGGGILAESMARTGATVRGIDLSTKALKVADLHSLESGVTVTYEEIAA
EALAARMPASVDVVTCMEMLEHVPDPQSVLRACATLVRPGGHVFCSTINRNLKAYLLAVV
GAEYVLKMLPRGTHDYDKFITPSELARYARNTGLELVEMRGMTYNPLTQVYSLGRDTDVN
YMMAFRRPA