Protein Info for RR42_RS04420 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): required for efflux of an amino acid polymer
Rationale: PFam PF08909.7 (DUF1854). In a conserved cofit operon with a mdlB-like transporter (RR42_RS04415) and with two (apparently cytoplasmic) cyanophycin synthetase-like genes that produce a different polymer (RR42_RS04410 and RR42_RS04405, see PMID:23224585)
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF08909: DUF1854" amino acids 30 to 159 (130 residues), 176.6 bits, see alignment E=9.8e-57

Best Hits

KEGG orthology group: None (inferred from 76% identity to rme:Rmet_0706)

Predicted SEED Role

"DUF1854 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5P9 at UniProt or InterPro

Protein Sequence (160 amino acids)

>RR42_RS04420 required for efflux of an amino acid polymer (Cupriavidus basilensis FW507-4G11)
MGAHMQQVDFKLSRNALGRLVMTTADGVVHDGVVPVRAFPIAAPDDGVGLVSADGRELAW
LPRLDTLPAPVREMIEAELASREFMPEIRRIRSVSTYATPSTWEVETDRGLTSLVLRGEE
DIRRLAGSTLLISDSHGIHYLVRNLASLDKGSRKILDRFL