Protein Info for RR42_RS04415 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 transmembrane" amino acids 184 to 206 (23 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 412 to 437 (26 residues), see Phobius details amino acids 443 to 461 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 186 to 459 (274 residues), 157.6 bits, see alignment E=5.6e-50 PF00005: ABC_tran" amino acids 525 to 673 (149 residues), 112.3 bits, see alignment E=3e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 86% identity to reh:H16_A0776)

Predicted SEED Role

"ABC transporter, transmembrane region:ABC transporter related"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7Z7 at UniProt or InterPro

Protein Sequence (762 amino acids)

>RR42_RS04415 ABC transporter (Cupriavidus basilensis FW507-4G11)
MTQPSLPVIDSDAQNEPWRNELGARLQPGEAVLAWLEVDLDAKLHFTQGWVLVTDRRLLA
RMPGQKDWQEWAIQPGLSLHHADHAGVGTLELQDSGRLLASWRYTLGYNPAALRLIDQFH
AQRDLSASGRAGQLDLDAEAVCPTCKAPLPPDDDQCPQCSRDLETPPSTWALLRLWRFAR
PYRFQLLAGFLLTLLSTAATLVPPYLTMPLMDNVLIPYQNGLPIDYDRVKLYLAGLLGAA
LVAWSLGWARTYLLARVSERIGADLRTTTYEHLLRLSLEYFGGKRTGDLMARIGSESDRI
CVFLSLHLLDFATDVLMIVMTAAILISINPWLALVTLVPLPFIAWMIHLVRDRLRHGFEK
IDRIWSEITNVLADTIPGIRVVKAFAQEKREVERFREANRHNLAINDRVNAVWSLFTPTV
TLLTEIGLLVVWIFGIWQVSHKAITVGVLVAFLTYISRFYTRLDSMSRIVSVTQKAAAGA
KRIFDILDHVSSVPEPTRPVHLERVEGAIELRDLGFRYGNRAVIRGLNLSIAPGEMIGLV
GHSGSGKSTLVNLICRFYDVSEGAIRLDGVDIRSLPVSEFRSHIGLVLQEPFLFFGTIAE
NIAYGKPGASREEIIAAARAAHAHEFILRLPHGYDSLVGERGQALSGGERQRISIARALL
INPRILIMDEATSSVDTTTEKEIQKALDNLVQGRTTIAIAHRLSTLRKADRLVVMDRGQI
VEVGNHDELLAREGAYYKLYQAQARNVDADADLTSADAVNVQ