Protein Info for RR42_RS04400 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 13 to 16 (4 residues), see Phobius details transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 108 (98 residues), 105.4 bits, see alignment E=9.3e-35 PF00528: BPD_transp_1" amino acids 32 to 214 (183 residues), 74.3 bits, see alignment E=5.5e-25

Best Hits

Swiss-Prot: 48% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 91% identity to cti:RALTA_A0760)

MetaCyc: 48% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCE0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>RR42_RS04400 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MSALQLVATSLPVLLQGMLLTIKFALLSMIFGLVLGTVVALMGISHQPVPKAVARAYVSI
MRGTPLLVQIFVVYYGLPGIGIALEPTPAGVLTLSLNVGAYLSESMRGAILGIPRGQWLA
AYSLGLTQGQALRYVIGPQALRLAVPSLSNSLISLIKDTSLVSVITVTELLRTAQEVIAA
TYQPLPLYLAVAAIYWMLSTALAHMQRLLERRLSLPGRH