Protein Info for RR42_RS04350 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00005: ABC_tran" amino acids 24 to 168 (145 residues), 125.6 bits, see alignment E=3.5e-40 PF08402: TOBE_2" amino acids 281 to 350 (70 residues), 45.9 bits, see alignment E=7.7e-16

Best Hits

Swiss-Prot: 42% identical to FBPC_NEIG1: Fe(3+) ions import ATP-binding protein FbpC (fbpC) from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 76% identity to cti:RALTA_A0750)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y0A5 at UniProt or InterPro

Protein Sequence (353 amino acids)

>RR42_RS04350 ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MPARSDIVIEVDRIHHGFGSQRVVDDLSFTLARGSIACLLGPSGCGKTTVLRAIAGFEPL
REGRILLQGQVMSSPGFAVAPEHRHIGMVFQDYALFPHLNVADNVAFGLHAVRRGERAER
VEEMLTLVGLAGSGGKFAHELSGGQQQRVALARALAPKPELLLLDEPFSNLDVDLRERLS
LEVRDILKAQGTTAILVTHDQYEAFAMADEIGVMHAGAIEQWDSAHNLYHRPATRVVADF
IGQGVLMPGLLASPHSVTLELGTLHSSEPLGVPPATAEVDVLIRPDDIVHDDDSPLRAKI
LHKAFRGAEILYTLRLAGGGQVLSLVPSHHDHALGDHIGIRVEVDDVVAFRRG