Protein Info for RR42_RS04145 in Cupriavidus basilensis FW507-4G11

Annotation: peptidase A24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 119 (30 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details PF01478: Peptidase_A24" amino acids 15 to 117 (103 residues), 66.8 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 59% identity to cti:RALTA_A0699)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5V1 at UniProt or InterPro

Protein Sequence (182 amino acids)

>RR42_RS04145 peptidase A24 (Cupriavidus basilensis FW507-4G11)
MLAQSALPQYVGPLVIVLVLTAAAIDAQQRRIPNWLTFGAWLLALPVQIILHGWGAGALA
WASGWLTGFALFLPLYLLRGMAAGDVKLMAAVGAWLGAPMAFEIALATFVAGGVWALALT
LWRGRLGQLRRNLAWMLTSFGQVRPTLTQDSGARNASSWSVGSLPYGVAIAAGTIGVLFA
SA