Protein Info for RR42_RS04015 in Cupriavidus basilensis FW507-4G11

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 10 to 173 (164 residues), 76.7 bits, see alignment E=8.2e-26 PF04542: Sigma70_r2" amino acids 13 to 77 (65 residues), 51.1 bits, see alignment E=1.4e-17 PF08281: Sigma70_r4_2" amino acids 121 to 172 (52 residues), 49.3 bits, see alignment E=4.7e-17 PF04545: Sigma70_r4" amino acids 125 to 172 (48 residues), 31.7 bits, see alignment 1.3e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 61% identity to reu:Reut_A1790)

Predicted SEED Role

"RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7V2 at UniProt or InterPro

Protein Sequence (232 amino acids)

>RR42_RS04015 RNA polymerase sigma factor (Cupriavidus basilensis FW507-4G11)
MNAADQRRRFDDLVLPHLDAAYNLARWLSGSPAEADDVVQEACLRAFCFFDSFRGDQPRA
WLLAIVRNTWFTTWRKRHQPGQAESAGYDDAHFDGEPLPGWQDGHGDSPEQWLLRAEDVR
LLHLALERLPLAFREVLVLRELEDLPYRDIAVIAQIPLGTVMSRLARARKLLAAAVLALR
AEGTRGLGTRGGADLGAAGTLSTAPVTDRAAAATAIHATPPQPAGETGHELQ