Protein Info for RR42_RS03995 in Cupriavidus basilensis FW507-4G11

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1120 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 224 to 256 (33 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF05231: MASE1" amino acids 22 to 284 (263 residues), 52.7 bits, see alignment E=1.7e-17 TIGR00229: PAS domain S-box protein" amino acids 299 to 424 (126 residues), 103.3 bits, see alignment E=1e-33 amino acids 554 to 683 (130 residues), 34.4 bits, see alignment E=2.1e-12 PF00989: PAS" amino acids 302 to 414 (113 residues), 37.1 bits, see alignment E=1.3e-12 amino acids 563 to 673 (111 residues), 29.4 bits, see alignment E=3.1e-10 PF08448: PAS_4" amino acids 308 to 418 (111 residues), 26.5 bits, see alignment E=3e-09 amino acids 475 to 547 (73 residues), 25.5 bits, see alignment 6e-09 amino acids 563 to 677 (115 residues), 34.5 bits, see alignment E=9.8e-12 PF13426: PAS_9" amino acids 313 to 415 (103 residues), 35.5 bits, see alignment E=4.7e-12 amino acids 568 to 674 (107 residues), 24.2 bits, see alignment E=1.5e-08 PF08447: PAS_3" amino acids 325 to 408 (84 residues), 50.6 bits, see alignment 8.4e-17 amino acids 452 to 539 (88 residues), 59.9 bits, see alignment 1e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 683 to 847 (165 residues), 138.2 bits, see alignment E=2.2e-44 PF00990: GGDEF" amino acids 687 to 844 (158 residues), 143 bits, see alignment E=3.4e-45 PF00563: EAL" amino acids 869 to 1102 (234 residues), 206.5 bits, see alignment E=1.8e-64

Best Hits

KEGG orthology group: None (inferred from 69% identity to rme:Rmet_0591)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5I4 at UniProt or InterPro

Protein Sequence (1120 amino acids)

>RR42_RS03995 diguanylate cyclase (Cupriavidus basilensis FW507-4G11)
MTPDLDVRPLPITYPRWQRVSLCAIAFFLLALAGLAVSRYPGNVAMLWLANAFGLGILLH
QRSGDALWQLAGMLAAGLAANAAIGDSPGIALALALGNVVEIAFSAWLVRAMTGGATLAR
PGPLARFALTLSAAGTLGPAVGATIGAATISTAYHSSFGAVWWTWWTADSMGIVMLLPLM
VSITRERFADTFRRAQLPRVAGLLLLSLAVGGVALYKSNEPFVVMALPLVLAALLTNPFA
TALLTLLAICGTVALGLGANEPFLLQSVQLSTTLIMVFPTCIAFLLEQNRRDRSELRGSE
RRFRQAMEHSAIGMALVGLDGRWLQVNHAICDLFGYDAAELAELPFPAITHPDDLAPDLR
QVERLLAGEIESYRIEKRFRHKDGHYRWTLLAVSLVHDENTGKPLHFISQVEDIDERKTA
LEKLEALSRRTQLAVEAGGVGIWEWDVASGAIEWDARMHALHGIDPALGAPDIKRWTAMV
HPEDVEQASTEMREAVRGTRTFDTEYRIQRPDGAVRHIRAMAMVLRQDDGTAVSMIGTNW
DITEQRRLTEALFEEKERLHITLRSIGDAVICTDASMGVTFMNPIAEQLTGWTMQAAAGQ
PLESIFRIVDEHTNAPIPSPVEQCLLTLRPVYLQDGAVLQSLTGDRHDVQDSAAPVRTAT
GEVIGAVLVFQDITGARALQRELAHSASHDALTGLPNRIWFEKRLREACDAARMQQQHHA
LCFIDLDRFKIVNDTAGHAAGDVLLRELGHVIRYHVRPHDLLARLGGDEFALLLMDCTVD
HAERVCQKIIDAIRGQRFPWEGRVYDVGASIGITAIDHETPPMGELMSRADVACYAAKAA
GRSRVSVYRRDESDAQRHHQELQVAAGIHSALDANRFRLFAQEIHALQRHNQAERHIEIL
VRMVDEQGKLVMPGAFIPAAERYDLMGHVDRWVIHHVLHEFGERLSAVPRLTVAINLSAN
SLGEPFLLPFLHAELHESVLPASRIQLEITETALINNMAAANRLVTEMRSAGCTVALDDF
GAGLSSFSYLKQFPVDYLKIDGSFIRHLAGNAVDREIVSSINDIGHRLGMLTVAESVEDE
ETLQALRSLGVDYAQGYVIGRPMPLELFLESCPTQPVDNA