Protein Info for RR42_RS03990 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): aspartate:proton symporter Glt
Rationale: Specifically important for asparagine utilization. Asparagine is probably cleaved in the periplasm (by RR42_RS12610 or RR42_RS26140) and RR42_RS03990 is 60% identical to aspartate transporter AO356_01905 from Pseudomonas fluorescens FW300-N2C3
Original annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 72 (25 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 195 to 223 (29 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 300 to 343 (44 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details PF00375: SDF" amino acids 7 to 403 (397 residues), 377.4 bits, see alignment E=4.2e-117

Best Hits

Swiss-Prot: 41% identical to DCTA_LARHH: C4-dicarboxylate transport protein (dctA) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: None (inferred from 89% identity to reh:H16_A0693)

Predicted SEED Role

"FIG00975494: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5S4 at UniProt or InterPro

Protein Sequence (436 amino acids)

>RR42_RS03990 aspartate:proton symporter Glt (Cupriavidus basilensis FW507-4G11)
MKLNRLPTLIFIAMLLGVLAGTAAHHYAPDPAAAKSIADHLSILTDVFLRMIKMIIGPLV
FATLVSGIASMGDGKAVGRIGMKAMAWFIAASITSLLLGLLMANLLRPGDGMNLALPAAD
AASNLKTGALNLREFIAHMFPKSFVEAMATNEILQIVVFSLFFGFALGTLKDGIGKPVLA
GIEGLSHVMLKITNYVMAFAPVGVFGAVAAVITAEGLGVLVVYAKLLGAVYLSLALLWVA
LIAGGYFFLGRDVFRLLKMVRAPLMIGFATASSESAYPKVIEQLGRFGVKERITGFVLPL
GYSFNLDGSIMYTSFAALFVAQVYGIHLSLSQQVTMLLVLLVTSKGIAGVPRASLVVVAA
VLPMFGLPEAGILLVLGIDHVLDMGRTVTNVLGNAIATTVVAKSEGAIGAPVPEEADDPA
ADGNRGLTPVQVLAGK