Protein Info for RR42_RS03940 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details PF04982: HPP" amino acids 66 to 185 (120 residues), 143.4 bits, see alignment E=4e-46 PF00571: CBS" amino acids 254 to 306 (53 residues), 45.9 bits, see alignment 5.8e-16 amino acids 318 to 373 (56 residues), 43.1 bits, see alignment 4.2e-15

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 72% identity to rme:Rmet_0583)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5R4 at UniProt or InterPro

Protein Sequence (389 amino acids)

>RR42_RS03940 membrane protein (Cupriavidus basilensis FW507-4G11)
MPPSQAPSLADFPPARARAWLRAFAPTPIAAGRRERVKSCLGALVGLLLTEWISRHLLGG
FNPWFIAPMGASAVLLFAVPASPLAQPWSIIGGNLVAALIGVACARWIPEPGLAASVAVA
LAIVAMFQLRCVHPPSGAVAITAVFGGHAVTQLGFGFVVMPVAVNSMLLLLVALLFNNLM
RRRYPHRPVEHANPHRTADPLPSERVGFNRSDLDEVLKARGEFLDIEEDDLEDILVAAQL
RAYRRHFGDVRCVDIMSRDVVTVQPGQSALEARALLFKHGIQALPVVDAQRRLLGMLGLA
DLLAARNGAEGQVRAGTAKDLMHTSMATARAEQPMVELARAFSNGGLHQVPVVDAQRRLL
GIVTQSDLIAALLEQGPPPKVEPTAQPAG