Protein Info for RR42_RS03925 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 11 to 300 (290 residues), 168.3 bits, see alignment E=5.3e-53 PF00070: Pyr_redox" amino acids 151 to 228 (78 residues), 44.2 bits, see alignment E=4.5e-15 PF18113: Rbx_binding" amino acids 314 to 387 (74 residues), 68.9 bits, see alignment E=5.2e-23

Best Hits

Swiss-Prot: 50% identical to RURE_PSEAE: Rubredoxin-NAD(+) reductase (alkT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05297, rubredoxin-NAD+ reductase [EC: 1.18.1.1] (inferred from 53% identity to pst:PSPTO_5473)

MetaCyc: 36% identical to NADH:flavorubredoxin reductase (Escherichia coli K-12 substr. MG1655)
Rubredoxin--NAD(+) reductase. [EC: 1.18.1.1]

Predicted SEED Role

"Rubredoxin-NAD(+) reductase (EC 1.18.1.1)" in subsystem Rubrerythrin (EC 1.18.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5H6 at UniProt or InterPro

Protein Sequence (388 amino acids)

>RR42_RS03925 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MTAKTQPALPLVILGTGLAGYTLAREFRKLDSATPLVIVTRDGGESYSKPMLSNALAGNK
APAALAIASAPTMAAQLNARVMTHADASAIDTAAGTVLVDGQALRYGKLVLALGAQARAP
GLQGDGADAVQTVNDLADYTRFHASLQGKRRVAILGAGLIGCEFANDLHAGGFDVELVDP
AAWPLGRLLPGEAGELMAGALRGLGARLHLGEMPVAVHRRDGALAVQLASGAQIAADVVL
SATGLLPRVALAQDGGIATARGIVVDRLLRTSAPSVYALGDCAEVDSLVLPYVMPLMQAA
RALARTLAGTPTPLRYAAMPVVVKTPVLPAVVSPALAGAGNWEIESQAAAGEAGAGLRAL
CRDTQGGLTGFALLGKAVAQKGALAKQI