Protein Info for RR42_RS03900 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 306 to 339 (34 residues), see Phobius details PF01594: AI-2E_transport" amino acids 12 to 342 (331 residues), 160.2 bits, see alignment E=3.8e-51

Best Hits

KEGG orthology group: None (inferred from 87% identity to reh:H16_A0685)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5H3 at UniProt or InterPro

Protein Sequence (374 amino acids)

>RR42_RS03900 membrane protein (Cupriavidus basilensis FW507-4G11)
MNSGQLIEKLAAIFALIVLIGGSLLVLAPFTTALLWGAILAFSSWYPYTVLSRWMGNRRS
LAALICVLLAAVIVLGPFVYAGASVSAHIDELSGLVDQFFDHGAPALPGWLTGLPYAGGY
LQSSWDKVIHADSEMVANLRKLIAPVGHAVLGAGLSIGAGLGQLALSIVLAFFFYTGGEF
AVAWLRAGMRRIAGERADHLLALAGNTVKGVVYGVLGTAFVQALLAGIGFWIAGVPGAAI
LGFITFFLSVIPVGPPLVWIPAALWLYHTGSLGWAIFMVVWGVGVVSMADNVIKPLLISK
GTDMPLIWVMLGVFGGALAFGFLGVFIGPTLLAVAYALLRDWTIGSQHLTDPPPALAQGK
PITTAEDVAGSGKA