Protein Info for RR42_RS03805 in Cupriavidus basilensis FW507-4G11

Annotation: phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01515: PTA_PTB
  • amino acids 84 to 298 (215 residues), 141.3 bits, E=2.4e-45

Best Hits

Swiss-Prot: 66% identical to PTAS_RHIML: Phosphate acetyltransferase (pta) from Rhizobium meliloti

KEGG orthology group: K00625, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 87% identity to reu:Reut_A0626)

MetaCyc: 41% identical to phosphotransbutyrylase subunit (Clostridium acetobutylicum)
Phosphate butyryltransferase. [EC: 2.3.1.19]

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

• heterolactic fermentation (15/18 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• sulfoacetaldehyde degradation I (2/2 steps found)
• mixed acid fermentation (12/16 steps found)
• (S)-propane-1,2-diol degradation (4/5 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate IV (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• sulfolactate degradation II (2/4 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of sulfolactate degradation (3/6 steps found)
• superpathway of taurine degradation (3/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• methanogenesis from acetate (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (2/8 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.19 or 2.3.1.8

Sequence Analysis Tools

See A0A0C4YC54 at UniProt or InterPro

Protein Sequence (313 amino acids)

>RR42_RS03805 phosphate acetyltransferase (Cupriavidus basilensis FW507-4G11)
MTHTPDKYSVLLARCQDLPAIPTAVAHPCDASSLGGALQAASLGLIVPLLIGPEARIRQV
ADANALDLGDSVLIDVPHSHAAAARAVAAVRAGEAELLMKGSLHTDELLHEVTASTTGLR
TGRRLSHVFAMDVPSYHKPLFITDAAVNIFPTLNDKADICRNAIDLLRVLGIERPKVAIL
SAVETVTDKIPSTIDAAALCMMSRRGQIEGGILDGPLAFDNAISHEAAVTKGIVSEVAGD
PDILLVPDLEAGNMLAKQLTFLAGAEAAGIVLGARVPIIVTSRADSVRARIGSCAIAVLL
AHARRTGQASSKV