Protein Info for RR42_RS03800 in Cupriavidus basilensis FW507-4G11

Annotation: acetate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR00016: acetate kinase" amino acids 6 to 401 (396 residues), 353.6 bits, see alignment E=6e-110 PF00871: Acetate_kinase" amino acids 8 to 394 (387 residues), 356.4 bits, see alignment E=8e-111

Best Hits

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 86% identity to reh:H16_A0670)

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5G2 at UniProt or InterPro

Protein Sequence (408 amino acids)

>RR42_RS03800 acetate kinase (Cupriavidus basilensis FW507-4G11)
MSATHPTILVVNAGSSSVKVSVYAVPEAAHANADINPVLSAHGQIEGIGVSPRLSASMAD
GRIVADERFPVAQVADHDAAFRLIRLVLSIGLRDAPPVAIGHRVVHGGADFSAAVKIDDD
VITKLEALIPLAPLHQPHNLTAIRAVRAAVPALLQVACFDTAFHAGHDPLAQLLALPYEY
FERGIRRYGFHGLSYEYIARRLQQIAPDLAQGRVIVAHLGNGASLCAMRDGRSVESTMGL
TALDGLPMGTRCGAIDAGAILWLSQQGMSTKDIETMLYQESGLKGLSGVSSDMRALLASD
APRARLAIDFYAYRAAQEIGKLAATLGGLDALVFTAGIGANSPPVREKICARLADLFGIS
LDAGANNENRQRISRDNSRVPVLVLPTDEEGMIALNTARIMMEHHARA