Protein Info for RR42_RS03795 in Cupriavidus basilensis FW507-4G11

Annotation: tyrosine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF13350: Y_phosphatase3" amino acids 2 to 232 (231 residues), 195.2 bits, see alignment E=8.8e-62

Best Hits

Swiss-Prot: 63% identical to Y669_CUPNH: Putative tyrosine-protein phosphatase H16_A0669 (H16_A0669) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 63% identity to reh:H16_A0669)

Predicted SEED Role

"Protein tyrosine phosphatase (EC 3.1.3.48)" (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7S6 at UniProt or InterPro

Protein Sequence (238 amino acids)

>RR42_RS03795 tyrosine protein phosphatase (Cupriavidus basilensis FW507-4G11)
MVNLRDLGGLATRDGHRVRGGKLFRSGNPGLASAADMERLRALQLDMVIDFRSPSEKTAA
ESPFGEAFRWVATPVLEGTMSMAELMPRLRDGSAQQMEAFMLEVYGDFPRKYQAAFGGFL
KTAEQGGNLLYHCTAGKDRTGFASMLLLAGLGVERGIIMANYLESNHWNQGFNQKMSAGA
AQFGVDPAVMWPLLAVKAAYLEASMQAIEQDYGGIDAYLGDVLKVDAGRLRQAYLVRA