Protein Info for RR42_RS03780 in Cupriavidus basilensis FW507-4G11

Annotation: lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF02615: Ldh_2" amino acids 4 to 335 (332 residues), 327.4 bits, see alignment E=5.1e-102

Best Hits

Swiss-Prot: 82% identical to LDH_CUPNH: L-lactate dehydrogenase (ldh) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 81% identity to rme:Rmet_0559)

Predicted SEED Role

"Hypothetical oxidoreductase, YbiC homolog"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5F9 at UniProt or InterPro

Protein Sequence (349 amino acids)

>RR42_RS03780 lactate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MKITLQSATRLARDLLAAQGVPTDIANDVAEHLVEADRCGYTSHGLSILPNYQRSLATGN
VNPAGRAECVLDRDSLLVFDGNGGFGQHVGKCVIETAIERVRQHGHCIVTLRRSHHLGRM
GHYGEMVAKERFVLLSFTNVINRSPVVAPYGGRTARLTTNPLCFAGPMPNGRPPLVVDIA
TSAIAINKARVLAEKGEPAPENSIIDGDGNPTTDAGAMFSEHPGALLPFGGHKGYALGVV
AELLAGVLSGGGTIQPENPRGGVATNNMFAVLMNPELDLGLSWQGAEVEAFVNYLHDTPP
APGFDNVQYPGEFEAANRALTTTHLEVNPAIWRNLETLAKELGVALPAG