Protein Info for RR42_RS03765 in Cupriavidus basilensis FW507-4G11

Annotation: formate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 31 to 273 (243 residues), 229 bits, E=2.7e-72
• PF02634: FdhD-NarQ
  • amino acids 35 to 272 (238 residues), 256.5 bits, E=1.4e-80

Best Hits

Swiss-Prot: 76% identical to FDHD_CUPNH: Sulfur carrier protein FdhD (fdhD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02379, FdhD protein (inferred from 77% identity to reu:Reut_A0620)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See A0A0C4Y040 at UniProt or InterPro

Protein Sequence (279 amino acids)

>RR42_RS03765 formate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MCELAMADAEPVTHSTFEVSRSRLGELALEDDEIAEEVPVALEYNGISHAVMLASPADLE
DFALGFSLSEGLVASPRDVYEIETEVRPEGIAVRLRIAAQAFAALKDRRRAMAGRTGCGL
CGTESLQEVMRAPAPVSSGASFGDAAMYAAFTQLQTRQELLRHTGATHAAAWLRADGQVA
LVREDVGRHNALDKLIGALARTGEDRSRGAVLVTSRASYEMVLKTASAGVGVLAAVSGPT
ALAVRLAIDAGITLAGFVRTGRHVVYSHPQRLHSRTEQP