Protein Info for RR42_RS03750 in Cupriavidus basilensis FW507-4G11

Annotation: formate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF01257: 2Fe-2S_thioredx" amino acids 18 to 160 (143 residues), 156.2 bits, see alignment E=2.6e-50

Best Hits

Swiss-Prot: 34% identical to NUOE2_RHIME: NADH-quinone oxidoreductase subunit E 2 (nuoE2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 73% identity to rme:Rmet_0553)

MetaCyc: 36% identical to NADH-quinone oxidoreductasesubunit E (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NAD-dependent formate dehydrogenase gamma subunit" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7S1 at UniProt or InterPro

Protein Sequence (171 amino acids)

>RR42_RS03750 formate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MSDSAAKPAASAVRDPVARIVAARHEMPGALLPILHEIQDTVGYVPADALPEIARALNLS
RAEVHGVVTFYHHFRDSKPGRHVVQVCRAEACQSVGSDALAAHAERALGCGFHETTADGA
FTLEPVYCLGQCACGPAVMIDGALAGRVTPQRFDTLIKACADVAVGQEVQA