Protein Info for RR42_RS03750 in Cupriavidus basilensis FW507-4G11

Annotation: formate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01257: 2Fe-2S_thioredx
  • amino acids 18 to 160 (143 residues), 156 bits, E=3.1e-50

Best Hits

Swiss-Prot: 34% identical to NUOE2_RHIME: NADH-quinone oxidoreductase subunit E 2 (nuoE2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 73% identity to rme:Rmet_0553)

MetaCyc: 36% identical to NADH-quinone oxidoreductasesubunit E (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NAD-dependent formate dehydrogenase gamma subunit" in subsystem Formate hydrogenase

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2 or 7.1.1.2

Sequence Analysis Tools

See A0A0C4Y7S1 at UniProt or InterPro

Protein Sequence (171 amino acids)

>RR42_RS03750 formate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MSDSAAKPAASAVRDPVARIVAARHEMPGALLPILHEIQDTVGYVPADALPEIARALNLS
RAEVHGVVTFYHHFRDSKPGRHVVQVCRAEACQSVGSDALAAHAERALGCGFHETTADGA
FTLEPVYCLGQCACGPAVMIDGALAGRVTPQRFDTLIKACADVAVGQEVQA