Protein Info for RR42_RS03460 in Cupriavidus basilensis FW507-4G11

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 23 to 338 (316 residues), 346.8 bits, E=6.1e-108
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 29 to 312 (284 residues), 219.5 bits, E=3e-69

Best Hits

Swiss-Prot: 80% identical to LPXK_CUPNJ: Tetraacyldisaccharide 4'-kinase (lpxK) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 82% identity to cti:RALTA_A0562)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (13/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (13/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See A0A0C4Y7M1 at UniProt or InterPro

Protein Sequence (369 amino acids)

>RR42_RS03460 tetraacyldisaccharide 4'-kinase (Cupriavidus basilensis FW507-4G11)
MPAPRNALADFVTAQWQRRGWFAWLMLPLSWVFGLVSAWRRLAYRRGWYSSTRLPMPVVV
VGNVTVGGTGKTPAVIALAHALAESGLRPGVVSRGYGVKLKHPRRVKPTSQAKDVGDEPL
LIARATDVPVWVFPDRALCAQTMLVSHPGINVLLLDDGLQHYKLQRDFEIVMFDSRMGGN
GLLLPAGPLRESLSRHRDATLINDPDFRPSPGQPDVYGMRLVLDDAWQLADPAMAKPLSA
FAGQRVLAAAGIGNPERFFASLRAAGLAPDTMPLPDHYDFAEDPFAGDPVAQAADAILIT
EKDAVKCERLSDPLDPRIWVVPTTPVIDAGLIEKIRRAVAAHAQAAPAAPGAATAAGHTK
ETRDGQPAA