Protein Info for RR42_RS03440 in Cupriavidus basilensis FW507-4G11

Annotation: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 196 (190 residues), 147.7 bits, E=4.4e-47
• PF08659: KR
  • amino acids 8 to 189 (182 residues), 26.7 bits, E=7.7e-10
• PF13561: adh_short_C2
  • amino acids 14 to 245 (232 residues), 138.6 bits, E=4e-44

Best Hits

Swiss-Prot: 57% identical to HCD2_DROME: 3-hydroxyacyl-CoA dehydrogenase type-2 (scu) from Drosophila melanogaster

KEGG orthology group: None (inferred from 92% identity to reu:Reut_A0589)

MetaCyc: 60% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Pseudomonas putida)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.178]

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) @ 17hydroxysteroid dehydrogenase type 10 (HSD10)-like" (EC 1.1.1.35)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• adipate biosynthesis (5/5 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• benzoyl-CoA degradation I (aerobic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (10/14 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (7/10 steps found)
• L-isoleucine degradation I (4/6 steps found)
• propanoate fermentation to 2-methylbutanoate (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• androstenedione degradation I (aerobic) (16/25 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• glycerol degradation to butanol (9/16 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• superpathway of testosterone and androsterone degradation (17/28 steps found)
• 2-methylpropene degradation (2/8 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (7/17 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (6/16 steps found)
• toluene degradation VI (anaerobic) (5/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (4/17 steps found)
• androstenedione degradation II (anaerobic) (10/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
• platensimycin biosynthesis (7/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (4/22 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (12/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35

Use Curated BLAST to search for 1.1.1.178 or 1.1.1.35

Sequence Analysis Tools

See A0A0C4Y5A7 at UniProt or InterPro

Protein Sequence (252 amino acids)

>RR42_RS03440 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MEIRDNVFIVTGGASGLGEGSARMLAAAGGKVVIADLNEAAGTALAAELGGKFVRCDVSS
EADGQATVAAATTLGRLAGLVNCAGIATANKTVGKNGPHPLDAFDKTIRVNLIGTFNMIR
LAAAAMVQNTPDAQGERGVIINTASVAAFDGQIGQAAYAASKGGVVAMTLAIARDLSRDG
VRCMTIAPGLFETPMLLGMPQEVQDALGKMVPFPPRLGRPAEYAKLVESIIANTMLNGEV
IRLDGAIRMQPK