Protein Info for RR42_RS03385 in Cupriavidus basilensis FW507-4G11

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 24 to 293 (270 residues), 140.3 bits, E=4.5e-45

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 72% identity to reh:H16_B1503)

Predicted SEED Role

"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• heterolactic fermentation (15/18 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• D-sorbitol degradation I (2/3 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• mannitol cycle (2/5 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.4

Sequence Analysis Tools

See A0A0C4Y7K6 at UniProt or InterPro

Protein Sequence (309 amino acids)

>RR42_RS03385 sugar kinase (Cupriavidus basilensis FW507-4G11)
MTTTSWPAYVVFGEALTDMVHQGGQDWLGLPGGSCWNVARVGARLGVPTAFAGAISADTL
GDQLAEASAEAGLDLRFLQRVERSPLLAFVGAQHPPQYFFVGDDSADLYFDPERLPPGWR
QAARTVHFGSLSLARQPLAARLCTEATQARAAGKRIAFDPNFRTPMRAPEYQAVFAHMAG
LADYIKVSDEDLRGLYPALDEHAALAALRALAPQARVLLTRGADGMTLLHGDGACEQPVF
AVDVVDTVGCGDAAMGGWMAGLLLDPEATLARQARWAAATAAVAATRAGAYSPTVAEVSV
LLGEAAVLA