Protein Info for RR42_RS03370 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): fructose ABC transporter, substrate-binding component (FrcB)
Rationale: Specific phenotype on fructose
Original annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 42 to 246 (205 residues), 45.3 bits, see alignment E=8.5e-16 PF13407: Peripla_BP_4" amino acids 43 to 296 (254 residues), 155.9 bits, see alignment E=1.5e-49

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 82% identity to reh:H16_B1500)

Predicted SEED Role

"Xylose ABC transporter, periplasmic xylose-binding protein XylF" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y591 at UniProt or InterPro

Protein Sequence (325 amino acids)

>RR42_RS03370 fructose ABC transporter, substrate-binding component (FrcB) (Cupriavidus basilensis FW507-4G11)
MFKQYLAALATAALSLLCTGAAAQSAPDAAPASAAAQRPLKKVGVTLGSLGNPYFVALAH
GAEAAAKKINPDAKVTVLSADYDLNKQFSHIDSFIVSKVDLILINAADARAIEPAVRKAR
KAGIVVVAVDVAAAGADATVQTDNTRAGELACAFLAGRLGGRGNLIIQNGPPVSAVLDRV
KGCKMVLGKHPGIHVLSDDQDGKGSREGGLNVMQLYLTRFPKIDAVFTINDPQAVGADLA
ARQLNRGGILIASVDGAPDIEAALKANTLVQASASQDPWAIARTAVEIGVGLMHGQAPAN
RTVLLPPTLVTRANVNEYKGWAAPR