Protein Info for RR42_RS03365 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): fructose ABC transporter, permease component (FrcC)
Rationale: Specific phenotype on fructose
Original annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 263 to 294 (32 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 55 to 319 (265 residues), 151.1 bits, see alignment E=1.8e-48

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 86% identity to reh:H16_B1499)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7K0 at UniProt or InterPro

Protein Sequence (333 amino acids)

>RR42_RS03365 fructose ABC transporter, permease component (FrcC) (Cupriavidus basilensis FW507-4G11)
MTRPAASTGAPLPAGTLGRLTTQERLRALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQ
QASINMVLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGMLSVPAALLCGLLF
GIVNGALVAFMKLPPFIVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWL
VIIAFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGG
VMSSARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVL
LGVSDIWQYIIKGLVIIGAVALDSYRRKGSART