Protein Info for RR42_RS03185 in Cupriavidus basilensis FW507-4G11

Annotation: branched-chain amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details PF03591: AzlC" amino acids 33 to 174 (142 residues), 110.8 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: None (inferred from 84% identity to reh:H16_A0574)

Predicted SEED Role

"Branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y544 at UniProt or InterPro

Protein Sequence (276 amino acids)

>RR42_RS03185 branched-chain amino acid permease (Cupriavidus basilensis FW507-4G11)
MTFRPPQALLRPWHRFAPAERAGFIEGARYFAPSLPAVFSWGLVTGVAMSKSVMNVPEAI
GMSLLVYAGSAQLSVLPLFAAGLPLWTVWLTAAIVNLRFVIFSAGLQPHFSYLPLWRRTL
LGSFNGDLHFVYFMQRYATPGHEPGKEGYFWGMALTNFAMWQVSSIIGIVLASAFPDSWG
LGLAGTLALIPVMVTTIRSRSTLLAVAVACALALLCFALPYRLGLVVAVVGAIAAGMASD
ELAARATLAGIRRRKAEHAPAQAAARSAAPAAKDRA