Protein Info for RR42_RS03060 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 466 to 491 (26 residues), see Phobius details amino acids 507 to 527 (21 residues), see Phobius details amino acids 533 to 554 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 28 to 238 (211 residues), 99.6 bits, see alignment E=2e-32 PF07690: MFS_1" amino acids 32 to 336 (305 residues), 81.3 bits, see alignment E=6.9e-27

Best Hits

KEGG orthology group: None (inferred from 91% identity to reu:Reut_A0523)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZQ0 at UniProt or InterPro

Protein Sequence (566 amino acids)

>RR42_RS03060 MFS transporter (Cupriavidus basilensis FW507-4G11)
MANAQNVAIPGGNAQNSAMTAEERKVIFASSLGTVFEWYDFYLYGSLAAIIAKQFFSGLD
PTAAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTILIMGASTFIVGLLPGFA
SIGWAAPIILIGLRMLQGLALGGEYGGAATYVAEHAPHGKRGAYTAWIQTTATLGLFLSL
IVILVCRNMTGANFEVWGWRIPFLVSILLLGVSVYIRLSMSESPAFQKMKAEGKTSKAPL
TEAFGQWRNLKIVILALIGLTAGQAVVWYTGQFYSLFFLTQVLKVDATTANLLIAGALVV
GTPFFIFFGSLSDKVGRKWIIMAGCALAMLTYFPLFKALTHYANPALERAQQSAQIVVTA
DPKQCSFQGSPIAREIDFRSSCDIVKRTLAQASASYEVVEAPAGTVASVKIGDKEIASFN
ASLVPAGHSFDDASKKQIAAFKKQVGESMASAGYPTKADPAQMNTIMVLVVLVILVIYVT
MVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTISFALVAQNGNIYYGLWYPI
IIAGVTLVLGSLFIRETKDVDIYAND