Protein Info for RR42_RS03045 in Cupriavidus basilensis FW507-4G11

Annotation: dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR00363: lipoprotein, YaeC family" amino acids 21 to 271 (251 residues), 263.4 bits, see alignment E=1.2e-82 PF03180: Lipoprotein_9" amino acids 35 to 273 (239 residues), 309.4 bits, see alignment E=1.3e-96

Best Hits

Swiss-Prot: 48% identical to METQ_ECO57: D-methionine-binding lipoprotein MetQ (metQ) from Escherichia coli O157:H7

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 86% identity to rme:Rmet_4789)

MetaCyc: 48% identical to L-methionine/D-methionine ABC transporter membrane anchored binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y518 at UniProt or InterPro

Protein Sequence (273 amino acids)

>RR42_RS03045 dioxygenase (Cupriavidus basilensis FW507-4G11)
MSGFSYPSLRQALSVAVATLGIVASGAAMAQEQTLRVGTVSGPDAQVWQVVQKVAKREGL
NIKVVEFNDYVQPNAALDAGDLDANSFQHQPYLDSQVKQRGYKMVSAGYTYISPLGIYSQ
KLKSPKDLPQGAKVAVPNDPSNENRALLLLAAQGVIKLKRGVGANGVNATPLDVSDNPKK
LKLVELDAAQLARSLPDVAAAVINTNYALAAGLQPTRNAIALEDIHSPYANIIAVRTQDK
DKPWVKKLVAAYQSEEVRQFMKNEFKGAMVPSF