Protein Info for RR42_RS03035 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 24 (2 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 238 (193 residues), 122 bits, see alignment E=1.3e-39 PF16576: HlyD_D23" amino acids 46 to 238 (193 residues), 48.9 bits, see alignment E=7.6e-17 PF13533: Biotin_lipoyl_2" amino acids 47 to 95 (49 residues), 63.3 bits, see alignment 2.1e-21 PF13437: HlyD_3" amino acids 156 to 238 (83 residues), 41.7 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 41% identical to AAEA_YERPE: p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) from Yersinia pestis

KEGG orthology group: None (inferred from 75% identity to rme:Rmet_4791)

MetaCyc: 41% identical to aromatic carboxylic acid efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-233

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y595 at UniProt or InterPro

Protein Sequence (322 amino acids)

>RR42_RS03035 membrane protein (Cupriavidus basilensis FW507-4G11)
MKLNLRTLGPIVLTLVVTAVAVVVVKHLWDYYTVAPWTRDGHIRADVVQIAPDVSGLVTK
VLVKDNQRVQRGQPLFEIDRDRFALALQQAQATVAAQSAMLAQARREARRSQTLSEVVSK
EVVEEGLAKVQQGEAALAQAQAAVNLAKLNLERTSVLSPVDGYLNDRLPRLGDYVNTGRP
VLSMVDANSFHVEGYFEETKLHGIHIGNPVDIRIMGESRVLHGHVQSIAAGIEDRDRTNG
SNLLPNVNPTFNWVRLAQRIPVRIALDEPPADLRMVAGRTATVSVREPSARDKAQAGPEG
QKDQKDKLALAAKGAASQGGAQ