Protein Info for RR42_RS03030 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): required for 4-hydroxybenzoate transport, together with NodT, MFP, and FUSC proteins (RR42_RS03040, RR42_RS03035, and RR42_RS03025)
Rationale: PFam PF07869.8 (DUF1656). Specifically important for utilization of 4-hydroxybenzoate (at 20 mM). Not clear if this system is for uptake or for efflux (as this compound is likely to be toxic at 20 mM)
Original annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07869: DUF1656
  • amino acids 4 to 59 (56 residues), 83.4 bits, E=4.6e-28

Best Hits

KEGG orthology group: None (inferred from 71% identity to rme:Rmet_4792)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

See A0A0C4XZP8 at UniProt or InterPro

Protein Sequence (69 amino acids)

>RR42_RS03030 required for 4-hydroxybenzoate transport, together with NodT, MFP, and FUSC proteins (RR42_RS03040, RR42_RS03035, and RR42_RS03025) (Cupriavidus basilensis FW507-4G11)
MSGEVDVYGVFVPSLLAWMLVAFLITACARAVLAHVGFYRLVWHRSLFNLALYVIVLGGI
VYLAYRLQS