Protein Info for RR42_RS03025 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Inner membrane protein (FUSC-like) required for 4-hydroxybenzoate transport, together with NodT, MFP, and DUF1656 proteins (RR42_RS03040, RR42_RS03035, and RR42_RS03030)
Rationale: specific phenotype on 4-hydroxybenzoate and cofit with other nearby components. Not clear if this is primarily an efflux pump (because of the high and potentially toxic concentration of hydroxybenzoate) or for uptake
Original annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 36 to 36 (1 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 409 (18 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details amino acids 468 to 488 (21 residues), see Phobius details amino acids 495 to 518 (24 residues), see Phobius details PF04632: FUSC" amino acids 9 to 665 (657 residues), 667.1 bits, see alignment E=3.5e-204 PF13515: FUSC_2" amino acids 22 to 152 (131 residues), 62.6 bits, see alignment E=4.3e-21

Best Hits

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBR9 at UniProt or InterPro

Protein Sequence (665 amino acids)

>RR42_RS03025 Inner membrane protein (FUSC-like) required for 4-hydroxybenzoate transport, together with NodT, MFP, and DUF1656 proteins (RR42_RS03040, RR42_RS03035, and RR42_RS03030) (Cupriavidus basilensis FW507-4G11)
MVSWPTGRDWIFSLKAFAAAMLALFIALYLGLPRPYWAMASVYIVAHPLTGATRSKALYR
VLGTLLGAAASVAIVPPLVNAPVLLMAAVALWTGILLYVALLHRTPRSYVFMLAAYTLPM
VALPSVSDPSGVFDIAVARAEEICLGIVCASIVGSTIFPAKVATVLGQKSAQWLADAALW
ATDMLSAHPAAKVSRHHSRHRLAADILALDQLISHLSYDAESAARVKHAQELRGRMTMLL
PVLSSLASVVDALHQHAAGIPQRLSHNMALVSAWISAGAQAPLPALQLSQDAPIDDAGLE
PGSAGPDWHAALAATAEGRLRELMELWQDCVSLQRRIGEAAPQGDWAPVFRRWGVGAARH
YDHGMLLFSTATTALAIFSMGMVWIWTGWADGAGAVALGAVSCCFFAAMDEPAPMIRSFF
RWNVVCLVLATIYLFVVLPNAHDFEMLVLMFAVPYLIIGVMMAQPRLALIAMPLAVVTAN
DIGIQGAYNADFNAFFNGNVAGIAGILFALVWTLVARPFGTRAAVRRLVRASWGDIARNA
TGREPGEHAHLRARMLDRLAQLVPRLAASEDETTGDGFTEVRVELSTLALQRELSALAPE
HQHSVRRVLQGVASYYQARLDARAEAPPQVLRDRLAKAIRKVASRADQASREAFAALVEM
HVALF