Protein Info for RR42_RS02785 in Cupriavidus basilensis FW507-4G11

Annotation: dimethyladenosine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00398: RrnaAD" amino acids 9 to 264 (256 residues), 205.6 bits, see alignment E=3.8e-65 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 10 to 267 (258 residues), 260.8 bits, see alignment E=5.8e-82

Best Hits

Swiss-Prot: 88% identical to RSMA_CUPMC: Ribosomal RNA small subunit methyltransferase A (rsmA) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 88% identity to rme:Rmet_0439)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4V6 at UniProt or InterPro

Protein Sequence (273 amino acids)

>RR42_RS02785 dimethyladenosine transferase (Cupriavidus basilensis FW507-4G11)
MRSNVHQGHVARKRFGQNFLVDDGIIHGIVSAIDPQHGDTLVEIGPGLGALTQPLLERLP
QMQVVELDRDLVERLRRRYGERLLIHAGDALAFDFGKLCEAGKPLRIVGNLPYNISSPLL
FHLAEFADQVRDQHFMLQKEVVERMVAEPGSKAFGRLSIMLQVRYHMEHVLDVPPASFNP
PPKVDSAVVRMIPWPRQPDGQLRSPYPACNLTVLGDVVAAAFSQRRKVLRNTLSMLRDQV
DFEALGFDLARRAEEVPVAEYVGLARQLETPAT