Protein Info for RR42_RS02780 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 7 to 333 (327 residues), 398.3 bits, see alignment E=1.5e-123 PF04166: PdxA" amino acids 40 to 329 (290 residues), 339.4 bits, see alignment E=9.6e-106

Best Hits

Swiss-Prot: 82% identical to PDXA_CUPNJ: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 82% identity to reu:Reut_A0499)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.262

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y754 at UniProt or InterPro

Protein Sequence (349 amino acids)

>RR42_RS02780 4-hydroxythreonine-4-phosphate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MSEPLALAITTGEPAGIGPDITVGALLQLAGEHPQVRFHVLGDAGLLAARAAALGVAQAW
AHRLADGSVVCDDIPLAVPCDAGRLDARNGGYVLALLDAAIDGCMGGTSGTRRFAGMVTA
PVQKSTINDAGVSFTGHTEYLAERAGVPRVVMMLAGPQPAHGNAMLRVALATTHLPLRAV
PDALTVSMLEETLAIVDHDLRRHFGIARPRILVTGLNPHAGESGHMGREEIDVIIPALAH
AVDAGIDARGPYPADTLFQPRHLDGADCVLAMYHDQGLAPLKYGTFGHGVNITLGLPFIR
TSVDHGTALDLAASGQAEHGSMIEAIRNAIAMAGHANGRPRAAPLVATR