Protein Info for RR42_RS02775 in Cupriavidus basilensis FW507-4G11

Annotation: molecular chaperone SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF09312: SurA_N" amino acids 82 to 199 (118 residues), 119.2 bits, see alignment E=3.5e-38 PF13623: SurA_N_2" amino acids 82 to 162 (81 residues), 36.3 bits, see alignment E=1.6e-12 PF13624: SurA_N_3" amino acids 84 to 195 (112 residues), 53.3 bits, see alignment E=8.7e-18 PF13616: Rotamase_3" amino acids 230 to 333 (104 residues), 50.8 bits, see alignment E=7e-17 amino acids 351 to 448 (98 residues), 91.9 bits, see alignment E=1.3e-29 PF00639: Rotamase" amino acids 239 to 331 (93 residues), 62.4 bits, see alignment E=2e-20 amino acids 356 to 445 (90 residues), 84.7 bits, see alignment E=2.2e-27 PF13145: Rotamase_2" amino acids 250 to 336 (87 residues), 31.3 bits, see alignment E=9.2e-11 amino acids 352 to 455 (104 residues), 33.5 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 81% identical to SURA_CUPNJ: Chaperone SurA (surA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 83% identity to cti:RALTA_A0468)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y541 at UniProt or InterPro

Protein Sequence (496 amino acids)

>RR42_RS02775 molecular chaperone SurA (Cupriavidus basilensis FW507-4G11)
MKRQEFNARPSMSSRLTGWQSLLLTALLAAFALPASAQLKAPGQKATGIFLPQAGDSAAA
SPSQPRLGVTQPGTSAQRSQLVDEVVAIVNNSVITRRELLDRADEIESQLRQANRPVPAR
ADLLGEVLERLVMERVQTQAAQDAGIKVTDQEVDRAIESVAQQNHINATDLRSQVERSGM
TWTKYRDELRKQVQVIRLREREVDSKIQVHDGEIDNYLAAHGGQGAADSGPTEFNVAQIL
VRVPEDASEAQKATLRAKAEGLLKQAQGGADFAQLALGSDGPEAAQGGALGFREIGRLPA
LFANAVLDLQPGGVAPQVIESANGFHVLKLVAKRTAPPAASNPAASDRITQTQVRHILIR
TGPNMPEAEARRQLATLRDRITHGGDFADAAKRFSQDGSAQNGGDLGWVSPGELVPEFEQ
AMSRLRPGEVSEPIVTQFGVHLIQVLNRRETEITPEKQRDFARAEIREQKARAAYEDWQR
QLRQAAYVEYRVNRQR