Protein Info for RR42_RS02370 in Cupriavidus basilensis FW507-4G11

Annotation: carbon monoxide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 8 to 61 (54 residues), 31.3 bits, E=1.6e-11
• PF01799: Fer2_2
  • amino acids 75 to 148 (74 residues), 114 bits, E=2.7e-37

Best Hits

Swiss-Prot: 59% identical to DCMS_OLICO: Carbon monoxide dehydrogenase small chain (coxS) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 84% identity to reh:H16_A0439)

MetaCyc: 59% identical to carbon monoxide dehydrogenase small chain (Afipia carboxidovorans)
RXN-17357 [EC: 1.2.5.3]

Predicted SEED Role

"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

• carbon monoxide oxidation to CO₂ (1/1 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.5.3 or 1.2.99.2

Sequence Analysis Tools

See A0A0C4Y4N4 at UniProt or InterPro

Protein Sequence (160 amino acids)

>RR42_RS02370 carbon monoxide dehydrogenase (Cupriavidus basilensis FW507-4G11)
MAIPIRLTVNGRAVDAQVEPHTLLVQFLREQLRLTGTHVGCDTAQCGACTVHMDGRAVKS
CNMLALQADGASITTIEGLAPEGQLHPMQEAFRNCHGLQCGFCTPGMVMSAIALVKQQPN
ADAAAIREQLDGNLCRCTGYHNIVRAVQEGQSAMHGVSAE