Protein Info for RR42_RS02150 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 283 (244 residues), 109.6 bits, see alignment E=1.6e-35 amino acids 246 to 413 (168 residues), 44.2 bits, see alignment E=1.3e-15 PF00083: Sugar_tr" amino acids 51 to 208 (158 residues), 34.4 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 88% identity to reu:Reut_A0368)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6T3 at UniProt or InterPro

Protein Sequence (418 amino acids)

>RR42_RS02150 membrane protein (Cupriavidus basilensis FW507-4G11)
MPSIHSSSQDAAKADDSKVQPAAGRDRMTGMEVRASISLASIFALRMLGLFLILPVFAEY
AHGLPDGHDAQRVGLAMGIYGLMQAFLHIPLGWLSDRVGRKPVMVAGLLLFVAGGLVAAN
SDTLSGIIIGRSLQGMGAISAAITACIADLTREQHRTKAMAMVGGSIGLTFALSLVIASP
LLHSIGMPGIFTLMSLLGVVAILVTLFLVPTPPPPHPVRLPFRSVLLNPDLIRLNVGVLA
LHASQVAMFMVVPAMLSDAGMPLDQHWKVYLPVVLVSFVLMLGPMMAAERYGKVRPVLLG
AVGLMTAVQLLFAAVHGLWGIVGVLLLFFVAFNVLEAMQPSLVSRYAAAARGAALGIYNT
TQAMGLFLGGAVGGWLLKHEGRSAVFIGCAVVLLLWLIIAWNMKSPPARKSSAQAVAA