Protein Info for RR42_RS02095 in Cupriavidus basilensis FW507-4G11

Annotation: organic solvent tolerance protein OstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR03002: lipopolysaccharide transport periplasmic protein LptA" amino acids 35 to 189 (155 residues), 122.3 bits, see alignment E=7.3e-40 PF03968: LptD_N" amino acids 47 to 163 (117 residues), 92.1 bits, see alignment E=1.4e-30

Best Hits

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 80% identity to reu:Reut_A0357)

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4R6 at UniProt or InterPro

Protein Sequence (214 amino acids)

>RR42_RS02095 organic solvent tolerance protein OstA (Cupriavidus basilensis FW507-4G11)
MNPFPTTSSCLRRSTAALLTLAAVLGLTLAAPASAEKADREKPLVLEADNASYDDVKQVY
VLTGNVVLTKGTMVLKSDAAEVRTDPEGYQYAVATSKGGKQAYIRQKRDNVDEYIDGWGD
RIEYDGKQELSKLIGRARMARLAGAKLVDEIRGAVITYDSRNEFYTASGGAENATAGSPS
GRVRAVLSPRQEQPASGAAASPLQLKPATAPVNP