Protein Info for RR42_RS02090 in Cupriavidus basilensis FW507-4G11

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 19 to 261 (243 residues), 385.4 bits, see alignment E=4.4e-120 PF00005: ABC_tran" amino acids 35 to 186 (152 residues), 119.4 bits, see alignment E=1.9e-38 PF12399: BCA_ABC_TP_C" amino acids 235 to 259 (25 residues), 28 bits, see alignment (E = 1.4e-10)

Best Hits

Swiss-Prot: 58% identical to LPTB_ECOLI: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Escherichia coli (strain K12)

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 90% identity to rme:Rmet_0304)

MetaCyc: 58% identical to lipopolysaccharide transport system ATP binding protein LptB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZ93 at UniProt or InterPro

Protein Sequence (261 amino acids)

>RR42_RS02090 sugar ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MTATQTAPSQPATLKDSSTLVVRHLKKRYGSRTVVKDVSLDVKSGEVVGLLGPNGAGKTT
SFYMIVGLVALDEGDIVLDDKHISGLAIHERARMGLSYLPQEASVFRKLNVQENIRAVLE
LQLNDGKPLSKAEIERRLDTLLDDLQIAHLRDNPALSLSGGERRRVEIARALASAPRFIL
LDEPFAGVDPIAVGEIQRIVSFLKARNIGVLITDHNVRETLGICDHAYIISEGAVLASGQ
PEDIIANESVRKVYLGENFRM