Protein Info for RR42_RS02065 in Cupriavidus basilensis FW507-4G11

Annotation: phosphate starvation-inducible protein PsiF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07769: PsiF_repeat" amino acids 36 to 66 (31 residues), 62.4 bits, see alignment E=1.5e-21 amino acids 76 to 106 (31 residues), 64.4 bits, see alignment E=3.3e-22

Best Hits

KEGG orthology group: None (inferred from 62% identity to rpf:Rpic12D_0286)

Predicted SEED Role

"Phosphate starvation-inducible protein PsiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB78 at UniProt or InterPro

Protein Sequence (107 amino acids)

>RR42_RS02065 phosphate starvation-inducible protein PsiF (Cupriavidus basilensis FW507-4G11)
MKKLIAMCVLVAPLFATGAFAQNAPAAAPAAPAAANTQQNKMKACNTQATGKKGDERKAF
MSDCLSNKPAAAPAKNSQQEKMKTCNAQATGKKGDERKAFMSDCLSK