Protein Info for RR42_RS02050 in Cupriavidus basilensis FW507-4G11

Annotation: adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01084: A/G-specific adenine glycosylase" amino acids 24 to 293 (270 residues), 312 bits, see alignment E=2e-97 PF00730: HhH-GPD" amino acids 54 to 185 (132 residues), 78.3 bits, see alignment E=8.4e-26 PF00633: HHH" amino acids 118 to 146 (29 residues), 25.2 bits, see alignment (E = 1.5e-09) PF14815: NUDIX_4" amino acids 262 to 382 (121 residues), 81.6 bits, see alignment E=5.7e-27

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 82% identity to reu:Reut_A0348)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4R0 at UniProt or InterPro

Protein Sequence (389 amino acids)

>RR42_RS02050 adenine glycosylase (Cupriavidus basilensis FW507-4G11)
MPRMPAASAAVSSDLSPAVVPADFAARVVGWQRVHGRHDLPWQNTRDPYRIWLSEIMLQQ
TQVSAVIEYFQRFIGRLPTVAALAEASADEVMALWAGLGYYSRARNLHRCAKAVMSEHGG
VFPTDPEVLVTLPGIGRSTAAAVAAFSAGVRSPILDGNVKRVFARFFGIHGHPGVKAVEN
RMWQLADAVLPAKGPAQAEDMVSYTQGVMDLGATVCSRGKPACLAAAASCPLASDCVARR
EGLTGVLPTPKPRAAIPERSTVMLLVRRGREVLLALRPDSGIWGGLWSLPEMPVDTVPFD
AELAEDAALERAREFGNPSTANMVGELTHVFTHFRLLIRAIRVDVAGLTARDAANGPALR
WLSLDDLDAVGTPAPVRKLLEAQAQGGLF